missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDC80 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56920-25ul
This item is not returnable.
View return policy
Description
NDC80 Polyclonal specifically detects NDC80 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| NDC80 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| HEC1KNTC2, HECRetinoblastoma-associated protein HEC, Highly expressed in cancer protein, highly expressed in cancer, rich in leucine heptad repeats, highly expressed in cancer, rich in leucine heptad repeats (yeast), hsHec1, hsNDC80, kinetochore associated 2, Kinetochore protein Hec1, kinetochore protein NDC80 homolog, Kinetochore-associated protein 2, NDC80 homolog, kinetochore complex component (S. cerevisiae), TID3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| NDC80 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ | |
| 25 μL | |
| Cell Biology, Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Mitotic Regulators, Stem Cell Markers | |
| 10403 | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction