missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NCOA7 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£149.00 - £366.00
Specifications
| Antigen | NCOA7 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18643590
|
Novus Biologicals
NBP2-94668-0.02ml |
0.02 mL |
£149.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18657290
|
Novus Biologicals
NBP2-94668-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NCOA7 Polyclonal antibody specifically detects NCOA7 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| NCOA7 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 135112 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| 140 kDa estrogen receptor-associated protein, dJ187J11.3, ERAP140Nbla00052, ESNA1, Estrogen nuclear receptor coactivator 1, estrogen receptor associated protein 140 kDa, FLJ45605, MGC88425, Nbla10993, nuclear receptor coactivator 7, putative protein product of Nbla00052, putative protein product of Nbla10993 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NCOA7 (NP_861447.3). MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVEEEYMTDEKKKRKSNQLKEIRRTELKRYYSI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title