missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NCOA7 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94668-0.1ml
This item is not returnable.
View return policy
Description
NCOA7 Polyclonal antibody specifically detects NCOA7 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| NCOA7 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| 140 kDa estrogen receptor-associated protein, dJ187J11.3, ERAP140Nbla00052, ESNA1, Estrogen nuclear receptor coactivator 1, estrogen receptor associated protein 140 kDa, FLJ45605, MGC88425, Nbla10993, nuclear receptor coactivator 7, putative protein product of Nbla00052, putative protein product of Nbla10993 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NCOA7 (NP_861447.3). MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVEEEYMTDEKKKRKSNQLKEIRRTELKRYYSI | |
| 0.1 mL | |
| Signal Transduction | |
| 135112 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction