missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAT13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£587.00
Specifications
| Antigen | NAT13 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
NAT13 Polyclonal antibody specifically detects NAT13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| NAT13 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS, pH 7.2, 40% glycerol | |
| 80218 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 2.3.1.-, FLJ13194, hSAN, Mak3 homolog (S. cerevisiae), N(alpha)-acetyltransferase 50, NatE catalytic subunit, N-acetyltransferase 13 (GCN5-related), N-acetyltransferase 5, N-acetyltransferase san homolog, NAT13San, NAT5SAN, NatE catalytic subunit, separation anxiety | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title