NAT13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17743-100UL

Product Code. 18338651

Description

NAT13 Polyclonal antibody specifically detects NAT13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: NAT13
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 2.3.1.-, FLJ13194, hSAN, Mak3 homolog (S. cerevisiae), N(alpha)-acetyltransferase 50, NatE catalytic subunit, N-acetyltransferase 13 (GCN5-related), N-acetyltransferase 5, N-acetyltransferase san homolog, NAT13San, NAT5SAN, NatE catalytic subunit, separation anxiety
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF
• Quantity: 100 μg
• Research Discipline: Cell Biology
• Gene ID (Entrez): 80218
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified