missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NARF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NARF |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NARF Polyclonal specifically detects NARF in Human samples. It is validated for Western Blot.Specifications
| NARF | |
| Polyclonal | |
| Rabbit | |
| Q9UHQ1-2 | |
| 26502 | |
| Synthetic peptides corresponding to NARF(nuclear prelamin A recognition factor) The peptide sequence was selected from the middle region of NARF. Peptide sequence FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ10067, IOP2DKFZp434G0420, Iron-only hydrogenase-like protein 2, nuclear prelamin A recognition factor, prenyl-dependent prelamin A binding protein | |
| NARF | |
| IgG | |
| 55 kDa |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto