NARF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54360

Product Code. 18271711

Description

NARF Polyclonal specifically detects NARF in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NARF
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ10067, IOP2DKFZp434G0420, Iron-only hydrogenase-like protein 2, nuclear prelamin A recognition factor, prenyl-dependent prelamin A binding protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 55 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Dog: 86%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UHQ1-2
• Gene Symbols: NARF
• Immunogen: Synthetic peptides corresponding to NARF(nuclear prelamin A recognition factor) The peptide sequence was selected from the middle region of NARF. Peptide sequence FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26502
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.