NAC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18443722	Novus Biologicals NBP1-89991-25ul	25 μL
18261317	Novus Biologicals NBP1-89991	0.1 mL

Description

NAC1 Polyclonal specifically detects NAC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NAC1
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: BEND8, BTB (POZ) domain containing 14B, BTB/POZ domain-containing protein 14B, BTBD14B, NAC1BEN domain containing 8, NAC-1FLJ37383, nucleus accumbens associated 1, BEN and BTB (POZ) domain containing, nucleus accumbens-associated protein 1, transcriptional repressor NAC1
• Gene Symbols: NACC1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, Chromatin Research, Embryonic Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 112939
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCH
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only