missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89991
This item is not returnable.
View return policy
Description
NAC1 Polyclonal specifically detects NAC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| NAC1 | |
| Polyclonal | |
| Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| BEND8, BTB (POZ) domain containing 14B, BTB/POZ domain-containing protein 14B, BTBD14B, NAC1BEN domain containing 8, NAC-1FLJ37383, nucleus accumbens associated 1, BEN and BTB (POZ) domain containing, nucleus accumbens-associated protein 1, transcriptional repressor NAC1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| NACC1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCH | |
| 0.1 mL | |
| Cancer, Chromatin Research, Embryonic Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators | |
| 112939 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction