missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYST3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56972
This item is not returnable.
View return policy
Description
MYST3 Polyclonal specifically detects MYST3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MYST3 | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| EC 2.3.1.48, EC 3.1.26.4, histone acetyltransferase MYST3, KAT6A, MGC167033, MOZMonocytic leukemia zinc finger protein, MYST histone acetyltransferase (monocytic leukemia) 3, MYST-3, runt-related transcription factor binding protein 2, Runt-related transcription factor-binding protein 2, RUNXBP2, Zinc finger protein 220, ZNF220MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| KAT6A | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSAPQEQYGECGEKSEATQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKCRLTEGSE | |
| 100 μL | |
| Epigenetics | |
| 7994 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction