missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYST3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | MYST3 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18257242
|
Novus Biologicals
NBP2-56972 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653028
|
Novus Biologicals
NBP2-56972-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MYST3 Polyclonal specifically detects MYST3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MYST3 | |
| Polyclonal | |
| Rabbit | |
| Epigenetics | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7994 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSAPQEQYGECGEKSEATQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKCRLTEGSE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.3.1.48, EC 3.1.26.4, histone acetyltransferase MYST3, KAT6A, MGC167033, MOZMonocytic leukemia zinc finger protein, MYST histone acetyltransferase (monocytic leukemia) 3, MYST-3, runt-related transcription factor binding protein 2, Runt-related transcription factor-binding protein 2, RUNXBP2, Zinc finger protein 220, ZNF220MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3 | |
| KAT6A | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title