missing translation for 'onlineSavingsMsg'
Learn More

MYO3A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

£385.00 - £587.00

Specifications

Antigen	MYO3A
Dilution	Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18339023 View Documents missing translation for 'viewProductCertificates'	Bio-Techne NBP3-17742-25UL	25 μg	£385.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18305266 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-17742-100UL	100 μg	£587.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

MYO3A Polyclonal antibody specifically detects MYO3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	MYO3A
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Protein Kinase, Vision
Formulation	PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)	53904
Isotype	IgG
Purification Method	Affinity purified

Dilution	Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	deafness, autosomal recessive 30, DFNB30, EC 2.7.11, EC 2.7.11.1, myosin IIIA, myosin-IIIa
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: KRRPRKDSQGKLLDLEDFYYKEFLPSRSGPKEHSPSLRERRPQQELQNQCIKANERCWAAESPEKEEEREPAANPYDFR
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto

Torna in alto

Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Il vostro nome

Indirizzo e-mail *

Tipo di problema *

Descrizione dettagliata del problema/richiesta *

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Annulla Invia

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato

MYO3A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documenti