missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYO3A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17742-100UL
This item is not returnable.
View return policy
Description
MYO3A Polyclonal antibody specifically detects MYO3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| MYO3A | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| deafness, autosomal recessive 30, DFNB30, EC 2.7.11, EC 2.7.11.1, myosin IIIA, myosin-IIIa | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KRRPRKDSQGKLLDLEDFYYKEFLPSRSGPKEHSPSLRERRPQQELQNQCIKANERCWAAESPEKEEEREPAANPYDFR | |
| 100 μg | |
| Protein Kinase, Vision | |
| 53904 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction