missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYF-5 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £359.00
Specifications
| Antigen | MYF-5 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18385954
|
Novus Biologicals
NBP3-10926-25UL |
25 μg |
£161.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18323486
|
Novus Biologicals
NBP3-10926-100UL |
100 μg |
£359.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MYF-5 Polyclonal specifically detects MYF-5 in Human, Mouse samples. It is validated for Western Blot.Specifications
| MYF-5 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| BHLHC2, bHLHc2Class C basic helix-loop-helix protein 2, myf-5, myogenic factor 5 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human MYF-5 (NP_005584). Peptide sequence ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 4617 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title