missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYF-5 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10926-25UL
Denne vare kan ikke returneres.
Se returpolicy
Beskrivelse
MYF-5 Polyclonal specifically detects MYF-5 in Human, Mouse samples. It is validated for Western Blot.
Tekniske data
| MYF-5 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| BHLHC2, bHLHc2Class C basic helix-loop-helix protein 2, myf-5, myogenic factor 5 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human MYF-5 (NP_005584). Peptide sequence ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK | |
| 25 μg | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4617 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion