missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYCL1/L-Myc Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | MYCL1/L-Myc |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18325012
|
Novus Biologicals
NBP3-17894-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18362502
|
Novus Biologicals
NBP3-17894-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MYCL1/L-Myc Polyclonal antibody specifically detects MYCL1/L-Myc in Human samples. It is validated for ImmunofluorescenceSpecifications
| MYCL1/L-Myc | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer | |
| PBS, pH 7.2, 40% glycerol | |
| 4610 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BHLHE38, bHLHe38myc-related gene from lung cancer, Class E basic helix-loop-helix protein 38, LMYCl-myc-1 proto-oncogene, MYCL, protein L-Myc-1, v-myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived, v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MCVCAGCRVSPSRRGAGPLQVAGGWSEGADMDYDSYQHYFY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title