missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYCL1/L-Myc Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17894-25UL
This item is not returnable.
View return policy
Description
MYCL1/L-Myc Polyclonal antibody specifically detects MYCL1/L-Myc in Human samples. It is validated for Immunofluorescence
Specifications
| MYCL1/L-Myc | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| BHLHE38, bHLHe38myc-related gene from lung cancer, Class E basic helix-loop-helix protein 38, LMYCl-myc-1 proto-oncogene, MYCL, protein L-Myc-1, v-myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived, v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MCVCAGCRVSPSRRGAGPLQVAGGWSEGADMDYDSYQHYFY | |
| 25 μg | |
| Breast Cancer | |
| 4610 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction