missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTSS1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£164.00 - £366.00
Specifications
| Antigen | MTSS1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18695500
|
Novus Biologicals
NBP2-93671-0.02ml |
0.02 mL |
£164.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18627810
|
Novus Biologicals
NBP2-93671-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MTSS1 Polyclonal antibody specifically detects MTSS1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| MTSS1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 9788 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| FLJ44694, KIAA0429Missing in metastasis protein, metastasis suppressor 1, metastasis suppressor protein 1, Metastasis suppressor YGL-1, MIMA, MIMB, MIMDKFZp781P2223, MTSS1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 630-730 of human MTSS1 (NP_055566.3). LPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQGED | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title