missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTSS1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93671-0.1ml
This item is not returnable.
View return policy
Description
MTSS1 Polyclonal antibody specifically detects MTSS1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| MTSS1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| FLJ44694, KIAA0429Missing in metastasis protein, metastasis suppressor 1, metastasis suppressor protein 1, Metastasis suppressor YGL-1, MIMA, MIMB, MIMDKFZp781P2223, MTSS1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 630-730 of human MTSS1 (NP_055566.3). LPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQGED | |
| 0.1 mL | |
| Cancer, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 9788 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction