missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTMR12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MTMR12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MTMR12 Polyclonal specifically detects MTMR12 in Human samples. It is validated for Western Blot.Specifications
| MTMR12 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| 3-PAP3PAP, 3-phosphatase adapter subunit, KIAA1682FLJ20476, myotubularin related protein 12, myotubularin-related protein 12,3-phosphatase adapter protein, Phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit, phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit, phosphatidylinositol-3-phosphate associated protein, PIP3AP | |
| MTMR12 | |
| IgG | |
| 86 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9C0I1 | |
| 54545 | |
| Synthetic peptides corresponding to MTMR12(myotubularin related protein 12) The peptide sequence was selected from the middle region of MTMR12. Peptide sequence PLYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title