missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTGR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | MTGR1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MTGR1 Polyclonal specifically detects MTGR1 in Mouse samples. It is validated for Western Blot.Specifications
| MTGR1 | |
| Polyclonal | |
| Rabbit | |
| NP_766448 | |
| 9139 | |
| Synthetic peptide directed towards the middle region of mouse CBFA2T2H. Peptide sequence RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| core-binding factor, runt domain, alpha subunit 2; translocated to, 2, EHTDKFZp313F2116, ETO homolog on chromosome 20, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, MTGR1p85, myeloid translocation gene-related protein 1, Myeloid translocation-related protein 1, protein CBFA2T2, ZMYND3 | |
| CBFA2T2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title