MTGR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-91617

Product Code. 18267988

Description

MTGR1 Polyclonal specifically detects MTGR1 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: MTGR1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: core-binding factor, runt domain, alpha subunit 2; translocated to, 2, EHTDKFZp313F2116, ETO homolog on chromosome 20, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, MTGR1p85, myeloid translocation gene-related protein 1, Myeloid translocation-related protein 1, protein CBFA2T2, ZMYND3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9139
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_766448
• Gene Symbols: CBFA2T2
• Immunogen: Synthetic peptide directed towards the middle region of mouse CBFA2T2H. Peptide sequence RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Aspergillus clavatus: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG