missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£317.00 - £530.00
Specifications
| Antigen | MTA2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18694564
|
Novus Biologicals
NBP3-21357-25ul |
25 μL |
£317.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18673964
|
Novus Biologicals
NBP3-21357-100ul |
100 μL |
£530.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MTA2 Polyclonal antibody specifically detects MTA2 in Human samples. It is validated for Western BlotSpecifications
| MTA2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Chromatin Research, Phospho Specific, Transcription Factors and Regulators, Tumor Suppressors | |
| PBS, pH 7.2, 40% glycerol | |
| 9219 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DKFZp686F2281, metastasis associated 1 family, member 2, metastasis -associated gene 1-like 1, metastasis associated gene family, member 2, Metastasis-associated 1-like 1, metastasis-associated protein 2, metastasis-associated protein MTA2, MTA1-L1 protein, MTA1L1MTA1-L1, p53 target protein in deacetylase complex, PID | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title