missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21357-100ul
This item is not returnable.
View return policy
Description
MTA2 Polyclonal antibody specifically detects MTA2 in Human samples. It is validated for Western Blot
Specifications
| MTA2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL | |
| DKFZp686F2281, metastasis associated 1 family, member 2, metastasis -associated gene 1-like 1, metastasis associated gene family, member 2, Metastasis-associated 1-like 1, metastasis-associated protein 2, metastasis-associated protein MTA2, MTA1-L1 protein, MTA1L1MTA1-L1, p53 target protein in deacetylase complex, PID | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK | |
| 100 μL | |
| Cancer, Chromatin Research, Phospho Specific, Transcription Factors and Regulators, Tumor Suppressors | |
| 9219 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction