missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MSL1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£164.00 - £366.00
Specifications
| Antigen | MSL1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18665102
|
Novus Biologicals
NBP2-94382-0.02ml |
0.02 mL |
£164.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18636502
|
Novus Biologicals
NBP2-94382-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MSL1 Polyclonal antibody specifically detects MSL1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| MSL1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| DKFZp686J17211, hMSL1, male-specific lethal 1 homolog, male-specific lethal 1 homolog (Drosophila), male-specific lethal 1-like 1, male-specific lethal-1 homolog 1, MGC141861, MSL-1, MSL1L1, MSL1-like 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 210-300 of human MSL1 (NP_001012241). LAVPSWRDHSVEPLRDPNPSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKGIQESEPEVTSFFPEPDDVES | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 339287 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title