missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MSL1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94382-0.02ml
This item is not returnable.
View return policy
Description
MSL1 Polyclonal antibody specifically detects MSL1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| MSL1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| DKFZp686J17211, hMSL1, male-specific lethal 1 homolog, male-specific lethal 1 homolog (Drosophila), male-specific lethal 1-like 1, male-specific lethal-1 homolog 1, MGC141861, MSL-1, MSL1L1, MSL1-like 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 210-300 of human MSL1 (NP_001012241). LAVPSWRDHSVEPLRDPNPSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKGIQESEPEVTSFFPEPDDVES | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 339287 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction