missing translation for 'onlineSavingsMsg'
Learn More

MSL1 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18665102 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18665102 0.02 mL 0.02mL
18636502 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18665102 Supplier Novus Biologicals Supplier No. NBP2943820.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

MSL1 Polyclonal antibody specifically detects MSL1 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen MSL1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias DKFZp686J17211, hMSL1, male-specific lethal 1 homolog, male-specific lethal 1 homolog (Drosophila), male-specific lethal 1-like 1, male-specific lethal-1 homolog 1, MGC141861, MSL-1, MSL1L1, MSL1-like 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-300 of human MSL1 (NP_001012241). LAVPSWRDHSVEPLRDPNPSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKGIQESEPEVTSFFPEPDDVES
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 339287
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.