missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MRPS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MRPS2 Polyclonal specifically detects MRPS2 in Human samples. It is validated for Western Blot.Specifications
| MRPS2 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| Q9Y399 | |
| 51116 | |
| Synthetic peptides corresponding to MRPS2(mitochondrial ribosomal protein S2) The peptide sequence was selected from the N terminal of MRPS2. Peptide sequence MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| 28S ribosomal protein S2, mitochondrial, CGI-91, mitochondrial 28S ribosomal protein S2, mitochondrial ribosomal protein S2, MRP-S2, S2mt | |
| MRPS2 | |
| IgG | |
| 33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title