missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-54663
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
MRPS2 Polyclonal specifically detects MRPS2 in Human samples. It is validated for Western Blot.
Spezifikation
| MRPS2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 28S ribosomal protein S2, mitochondrial, CGI-91, mitochondrial 28S ribosomal protein S2, mitochondrial ribosomal protein S2, MRP-S2, S2mt | |
| Rabbit | |
| 33 kDa | |
| 100 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 51116 | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9Y399 | |
| MRPS2 | |
| Synthetic peptides corresponding to MRPS2(mitochondrial ribosomal protein S2) The peptide sequence was selected from the N terminal of MRPS2. Peptide sequence MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur