missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPS12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | MRPS12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MRPS12 Polyclonal specifically detects MRPS12 in Human samples. It is validated for Western Blot.Specifications
| MRPS12 | |
| Polyclonal | |
| Rabbit | |
| O15235 | |
| 6183 | |
| Synthetic peptides corresponding to MRPS12(mitochondrial ribosomal protein S12) The peptide sequence was selected from the N terminal of MRPS12. Peptide sequence LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 28S ribosomal protein S12, mitochondrial, mitochondrial ribosomal protein S12, MPR-S12, MRP-S12, MT-RPS12, ribosomal protein, mitochondrial, S12, RPMS12, RPS12, RPSM12S12mt | |
| MRPS12 | |
| IgG | |
| 12 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title