MRPS12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54647

Product Code. 18281235

Description

MRPS12 Polyclonal specifically detects MRPS12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MRPS12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 28S ribosomal protein S12, mitochondrial, mitochondrial ribosomal protein S12, MPR-S12, MRP-S12, MT-RPS12, ribosomal protein, mitochondrial, S12, RPMS12, RPS12, RPSM12S12mt
• Host Species: Rabbit
• Molecular Weight of Antigen: 12 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Bovine: 86%; Guinea pig: 86%; Equine: 79%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O15235
• Gene Symbols: MRPS12
• Immunogen: Synthetic peptides corresponding to MRPS12(mitochondrial ribosomal protein S12) The peptide sequence was selected from the N terminal of MRPS12. Peptide sequence LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6183
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.