missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£343.00 - £557.00
Specifications
| Antigen | MRP2 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18334305
|
Novus Biologicals
NBP3-17039-25UL |
25 μg |
£343.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18370543
|
Bio-Techne
NBP3-17039-100UL |
100 μg |
£557.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MRP2 Polyclonal antibody specifically detects MRP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| MRP2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| ABC Transporters, Amino Acids Drugs and other small molecules, Cancer, Diabetes Research, Lipid and Metabolism | |
| PBS, pH 7.2, 40% glycerol | |
| 1244 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ATP-binding cassette, sub-family C (CFTR/MRP), member 2, Canalicular multidrug resistance protein, canalicular multispecific organic anion transporter 1, CMOAT1, CMOATABC30, CMRP, DJS, KIAA1010, MRP2ATP-binding cassette sub-family C member 2, Multidrug resistance-associated protein 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: NNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGAR | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel