MRP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17039-100UL

Product Code. 18370543

Description

MRP2 Polyclonal antibody specifically detects MRP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: MRP2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: ATP-binding cassette, sub-family C (CFTR/MRP), member 2, Canalicular multidrug resistance protein, canalicular multispecific organic anion transporter 1, CMOAT1, CMOATABC30, CMRP, DJS, KIAA1010, MRP2ATP-binding cassette sub-family C member 2, Multidrug resistance-associated protein 2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGAR
• Quantity: 100 μg
• Research Discipline: ABC Transporters, Amino Acids Drugs and other small molecules, Cancer, Diabetes Research, Lipid and Metabolism
• Gene ID (Entrez): 1244
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified