missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRO Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MRO |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MRO Polyclonal specifically detects MRO in Human samples. It is validated for Western Blot.Specifications
| MRO | |
| Polyclonal | |
| Rabbit | |
| NP_001120648 | |
| 83876 | |
| Synthetic peptide directed towards the C terminal of human MROThe immunogen for this antibody is MRO. Peptide sequence VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B29FLJ30140, beside the Ma29 deletion, C18orf3, chromosome 18 open reading frame 3, maestro, Male-specific transcription in the developing reproductive organs, Protein B29, protein maestro | |
| MRO | |
| IgG | |
| 30 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title