MRO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79844

Product Code. 18268155

Description

MRO Polyclonal specifically detects MRO in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MRO
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B29FLJ30140, beside the Ma29 deletion, C18orf3, chromosome 18 open reading frame 3, maestro, Male-specific transcription in the developing reproductive organs, Protein B29, protein maestro
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 85%; Horse: 85%; Bovine: 85%; Rabbit: 85%; Rat: 77%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001120648
• Gene Symbols: MRO
• Immunogen: Synthetic peptide directed towards the C terminal of human MROThe immunogen for this antibody is MRO. Peptide sequence VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83876
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.