missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRCK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55964
This item is not returnable.
View return policy
Description
MRCK Polyclonal specifically detects MRCK in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| MRCK | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| CDC42 binding protein kinase alpha (DMPK-like), CDC42 binidng protein kinase beta, CDC42-binding protein kinase alpha, CDC42-binding protein kinase alpha (DMPK-like), DMPK-like alpha, EC 2.7.11, EC 2.7.11.1, KIAA0451DKFZp686L1738, MRCK, MRCK alpha, MRCKADKFZp686P1738, Myotonic dystrophy kinase-related CDC42-binding kinase alpha, myotonic dystrophy kinase-related CDC42-binding protein kinase alpha, Myotonic dystrophy protein kinase-like alpha, PK428FLJ23347, serine/threonine-protein kinase MRCK alpha, ser-thr protein kinase PK428, ser-thr protein kinase related to the myotonic dystrophy protein kinase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CDC42BPA | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD | |
| 100 μL | |
| Protein Kinase | |
| 8476 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction