MRCK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18284502	Novus Biologicals NBP2-55964	100 μL
18633527	Novus Biologicals NBP2-55964-25ul	25 μL

Description

MRCK Polyclonal specifically detects MRCK in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MRCK
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Protein Kinase
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 8476
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: CDC42 binding protein kinase alpha (DMPK-like), CDC42 binidng protein kinase beta, CDC42-binding protein kinase alpha, CDC42-binding protein kinase alpha (DMPK-like), DMPK-like alpha, EC 2.7.11, EC 2.7.11.1, KIAA0451DKFZp686L1738, MRCK, MRCK alpha, MRCKADKFZp686P1738, Myotonic dystrophy kinase-related CDC42-binding kinase alpha, myotonic dystrophy kinase-related CDC42-binding protein kinase alpha, Myotonic dystrophy protein kinase-like alpha, PK428FLJ23347, serine/threonine-protein kinase MRCK alpha, ser-thr protein kinase PK428, ser-thr protein kinase related to the myotonic dystrophy protein kinase
• Gene Symbols: CDC42BPA
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only