missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MPG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | MPG |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
MPG Polyclonal specifically detects MPG in Human samples. It is validated for Western Blot, Immunoprecipitation.Specifications
| MPG | |
| Unconjugated | |
| RUO | |
| 3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on16p, 3-alkyladenine DNA glycosylase, 3-methyladenine DNA glycosidase, AAG, ADPG, ANPG, APNG, CRA36.1, CRA36.1 (3-methyl-adenine DNA glycosylase), DNA-3-methyladenine glycosylase, EC 3.2.2.21, MDGalkyladenine DNA glycosylase, Mid1, N-methylpurine-DNA glycosylase, MPG, N-methylpurine-DNA glycosylasePIG16, PIG11, proliferation-inducing protein 11, proliferation-inducing protein 16 | |
| MPG | |
| IgG |
| Polyclonal | |
| Rabbit | |
| Q5J9I4 | |
| 4350 | |
| Synthetic peptides corresponding to MPG(N-methylpurine-DNA glycosylase) The peptide sequence was selected from the C terminal of MPG. Peptide sequence LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title