MPG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59730

Product Code. 18283475

Description

MPG Polyclonal specifically detects MPG in Human samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: MPG
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on16p, 3-alkyladenine DNA glycosylase, 3-methyladenine DNA glycosidase, AAG, ADPG, ANPG, APNG, CRA36.1, CRA36.1 (3-methyl-adenine DNA glycosylase), DNA-3-methyladenine glycosylase, EC 3.2.2.21, MDGalkyladenine DNA glycosylase, Mid1, N-methylpurine-DNA glycosylase, MPG, N-methylpurine-DNA glycosylasePIG16, PIG11, proliferation-inducing protein 11, proliferation-inducing protein 16
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4350
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunoprecipitation
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunoprecipitation
• Gene Accession No.: Q5J9I4
• Gene Symbols: MPG
• Immunogen: Synthetic peptides corresponding to MPG(N-methylpurine-DNA glycosylase) The peptide sequence was selected from the C terminal of MPG. Peptide sequence LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 84%; Rabbit: 84%; Guinea pig: 78%; Pig: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG