RAVER2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57133

Product Code. 18279372

Description

RAVER2 Polyclonal specifically detects RAVER2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RAVER2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp762D1011, KIAA1579FLJ10770, Protein raver-2, ribonucleoprotein PTB-binding 2, ribonucleoprotein, PTB-binding 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55225
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9HCJ3-2
• Gene Symbols: RAVER2
• Immunogen: Synthetic peptides corresponding to RAVER2(ribonucleoprotein, PTB-binding 2) The peptide sequence was selected from the middle region of RAVER2. Peptide sequence TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rabbit: 92%; Bovine: 85%.
• Target Species: Human, Mouse, Bovine, Rabbit
• Isotype: IgG