missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAVER2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RAVER2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RAVER2 Polyclonal specifically detects RAVER2 in Human samples. It is validated for Western Blot.Specifications
| RAVER2 | |
| Polyclonal | |
| Rabbit | |
| Q9HCJ3-2 | |
| 55225 | |
| Synthetic peptides corresponding to RAVER2(ribonucleoprotein, PTB-binding 2) The peptide sequence was selected from the middle region of RAVER2. Peptide sequence TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp762D1011, KIAA1579FLJ10770, Protein raver-2, ribonucleoprotein PTB-binding 2, ribonucleoprotein, PTB-binding 2 | |
| RAVER2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title