missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MMP20 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MMP20 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MMP20 Polyclonal specifically detects MMP20 in Human samples. It is validated for Western Blot.Specifications
| MMP20 | |
| Polyclonal | |
| Rabbit | |
| O60882 | |
| 9313 | |
| Synthetic peptides corresponding to MMP20(matrix metallopeptidase 20) The peptide sequence was selected from the middle region of MMP20. Peptide sequence AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| AI2A2, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.22, EC 3.4.24.35, Enamel metalloproteinase, Enamelysin, matrix metallopeptidase 20, matrix metalloproteinase 20 (enamelysin), matrix metalloproteinase-20, MMP-20 | |
| MMP20 | |
| IgG | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title