missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MMD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MMD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MMD2 Polyclonal specifically detects MMD2 in Human samples. It is validated for Western Blot.Specifications
| MMD2 | |
| Polyclonal | |
| Rabbit | |
| Q8IY49 | |
| 221938 | |
| Synthetic peptides corresponding to MMD2(monocyte to macrophage differentiation-associated 2) The peptide sequence was selected from the N terminal of MMD2. Peptide sequence FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ37205, monocyte to macrophage differentiation factor 2, monocyte to macrophage differentiation-associated 2, monocyte-to-macrophage differentiation factor 2, PAQR10Progestin and adipoQ receptor family member 10, Progestin and adipoQ receptor family member X | |
| MMD2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title