MMD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56388

Product Code. 18283873

Description

MMD2 Polyclonal specifically detects MMD2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MMD2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ37205, monocyte to macrophage differentiation factor 2, monocyte to macrophage differentiation-associated 2, monocyte-to-macrophage differentiation factor 2, PAQR10Progestin and adipoQ receptor family member 10, Progestin and adipoQ receptor family member X
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 221938
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IY49
• Gene Symbols: MMD2
• Immunogen: Synthetic peptides corresponding to MMD2(monocyte to macrophage differentiation-associated 2) The peptide sequence was selected from the N terminal of MMD2. Peptide sequence FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Mouse: 92%; Rat: 85%; Chicken: 78%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG