missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MMADHC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MMADHC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MMADHC Polyclonal specifically detects MMADHC in Human samples. It is validated for Western Blot.Specifications
| MMADHC | |
| Polyclonal | |
| Rabbit | |
| NP_056517 | |
| 27249 | |
| Synthetic peptide directed towards the N terminal of human C2orf25. Peptide sequence GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cblD, chromosome 2 open reading frame 25, methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria, mitochondrial, protein C2orf25, mitochondrial | |
| MMADHC | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title