MMADHC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79585

Product Code. 18257275

Description

MMADHC Polyclonal specifically detects MMADHC in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MMADHC
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cblD, chromosome 2 open reading frame 25, methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria, mitochondrial, protein C2orf25, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_056517
• Gene Symbols: MMADHC
• Immunogen: Synthetic peptide directed towards the N terminal of human C2orf25. Peptide sequence GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL.
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 27249
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG