missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MKK7/MEK7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MKK7/MEK7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MKK7/MEK7 Polyclonal specifically detects MKK7/MEK7 in Human samples. It is validated for Western Blot.Specifications
| MKK7/MEK7 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| c-Jun N-terminal kinase kinase 2, dual specificity mitogen-activated protein kinase kinase 7, EC 2.7.12.2, JNK kinase 2, JNK-activating kinase 2, JNKK 2, JNKK2, MAP kinase kinase 7, MAPK/ERK kinase 7, MAPKK7, MEK 7, MEK7, mitogen-activated protein kinase kinase 7, MKK7MAPKK 7, PRKMK7 | |
| MAP2K7 | |
| IgG | |
| 47 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O14733 | |
| 5609 | |
| Synthetic peptides corresponding to MAP2K7(mitogen-activated protein kinase kinase 7) The peptide sequence was selected from the middle region of MAP2K7. Peptide sequence ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title