missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MGC4172 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MGC4172 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MGC4172 Polyclonal specifically detects MGC4172 in Human samples. It is validated for Western Blot.Specifications
| MGC4172 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| ARPG836, dehydrogenase/reductase (SDR family) member 11, dehydrogenase/reductase SDR family member 11, FLJ39232, MGC4172, SDR24C1, short chain dehydrogenase/reductase family 24C, member 1, short-chain dehydrogenase/reductase | |
| DHRS11 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q6UWP2 | |
| 79154 | |
| Synthetic peptides corresponding to MGC4172(short-chain dehydrogenase/reductase) The peptide sequence was selected from the middle region of MGC4172. Peptide sequence DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title