MGC4172 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59993

Product Code. 18284803

Description

MGC4172 Polyclonal specifically detects MGC4172 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MGC4172
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ARPG836, dehydrogenase/reductase (SDR family) member 11, dehydrogenase/reductase SDR family member 11, FLJ39232, MGC4172, SDR24C1, short chain dehydrogenase/reductase family 24C, member 1, short-chain dehydrogenase/reductase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6UWP2
• Gene Symbols: DHRS11
• Immunogen: Synthetic peptides corresponding to MGC4172(short-chain dehydrogenase/reductase) The peptide sequence was selected from the middle region of MGC4172. Peptide sequence DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR.
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 79154
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG