missing translation for 'onlineSavingsMsg'
Learn More
Learn More
METTL19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | METTL19 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
METTL19 Polyclonal specifically detects METTL19 in Human samples. It is validated for Western Blot.Specifications
| METTL19 | |
| Polyclonal | |
| Rabbit | |
| FLJ12891, FLJ35725, methyltransferase like 19, methyltransferase-like protein 19, probable tRNA (uracil-O(2)-)-methyltransferase | |
| TRMT44 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 152992 | |
| Synthetic peptides corresponding to C4ORF23 The peptide sequence was selected from the N terminal of C4ORF23. Peptide sequence LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title