METTL19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-70636

Product Code. 18244031

Description

METTL19 Polyclonal specifically detects METTL19 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: METTL19
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: TRMT44
• Immunogen: Synthetic peptides corresponding to C4ORF23 The peptide sequence was selected from the N terminal of C4ORF23. Peptide sequence LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Chicken: 100%; Xenopus: 100%; Human: 100%Mouse: 92%; Canine: 92%; Bovine: 84%; Green puffer: 78%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: FLJ12891, FLJ35725, methyltransferase like 19, methyltransferase-like protein 19, probable tRNA (uracil-O(2)-)-methyltransferase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 152992
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.